prepaid guthaben nicht gutgeschrieben

"context" : "", "action" : "rerender" } ] "event" : "expandMessage", { { "includeRepliesModerationState" : "false", ] }); "action" : "rerender" "dialogContentCssClass" : "lia-panel-dialog-content", }, } "event" : "markAsSpamWithoutRedirect", { "action" : "rerender" { "event" : "removeMessageUserEmailSubscription", ] // just for convenience, you need a login anyways... "actions" : [ "context" : "", "useCountToKudo" : "false", // We're good so far. { "action" : "rerender" LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1667751}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1671935}},{"elementId":"link_19","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1667946}},{"elementId":"link_23","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1668159}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1668309}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1668939}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1670043}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1670076}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1670200}},{"elementId":"link_48","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1671935}},{"elementId":"link_53","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1672428}}]); "event" : "ProductAnswer", "actions" : [ { // Set start to true only if the first key in the sequence is pressed "context" : "", "context" : "envParam:quiltName,message", "entity" : "1672428", "action" : "rerender" { "action" : "rerender" "actions" : [ } "actions" : [ "actions" : [ // console.log('watching: ' + key); "actions" : [ "action" : "rerender" ] }, "action" : "rerender" ] } { "action" : "pulsate" } "action" : "pulsate" } ] "action" : "rerender" { { { { "initiatorBinding" : true, "event" : "MessagesWidgetMessageEdit", { "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1672428 .lia-rating-control-passive', '#form_9'); "context" : "envParam:quiltName,product,contextId,contextUrl", var o = document.getElementById("custom_board_pagination_warning" + pagerId); } { "disallowZeroCount" : "false", "context" : "", "includeRepliesModerationState" : "false", }, }, "actions" : [ }, } "action" : "rerender" }, if (1 != val) } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_50","feedbackSelector":".InfoMessage"}); "event" : "removeThreadUserEmailSubscription", "useCountToKudo" : "false", "actions" : [ return; "context" : "lia-deleted-state", "action" : "rerender" } "action" : "rerender" LITHIUM.InputEditForm("form_9", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" } "actions" : [ "actions" : [ } "event" : "ProductAnswerComment", "}); "context" : "envParam:feedbackData", }, "event" : "MessagesWidgetEditAction", { "actions" : [ } { ] ;(function($) { ] ] "action" : "rerender" ;(function($) { }, } "event" : "editProductMessage", { { { { "event" : "QuickReply", ] "context" : "", "selector" : "#messageview_0", } "actions" : [ { "actions" : [ "action" : "rerender" "actions" : [ logmein: [76, 79, 71, 77, 69, 73, 78], "actions" : [ "context" : "envParam:selectedMessage", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); if ( Number(val) > 3 ) { ] LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234034}); "context" : "", { ] { "action" : "rerender" return false; { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "editProductMessage", "action" : "addClassName" count++; }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_9","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" ] "eventActions" : [ ;(function($) { "actions" : [ ] "action" : "rerender" "useSimpleView" : "false", "actions" : [ } "kudosLinksDisabled" : "false", "displaySubject" : "true", "context" : "", "quiltName" : "ForumMessage", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "addThreadUserEmailSubscription", "action" : "rerender" }, } } { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":998,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBFcKAVNRA1cFBxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVcBQNQAFxQVRRUV1cDSQEGVwRIDwQOCk9SVlJQVgIGXFADCQBAThUPVn1bVgB\/AhsIQCNFB11aQm0mVwpVawNAG0ZeUGZXFkIwC2MXB0UdFwkWYSB6I3pmQgtTRHNhe39FWwNKQQMFUhcVZHx3N3NGTV0SC1RKXFcJDUV6L3R7NkIIRkhO"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "action" : "rerender" "actions" : [ LITHIUM.Dialog.options['-244757137'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "MessagesWidgetAnswerForm", } "includeRepliesModerationState" : "false", { "action" : "rerender" "actions" : [ "action" : "rerender" > 0) ) "action" : "rerender" "action" : "rerender" "}); "disableLinks" : "false", } "event" : "editProductMessage", { "displaySubject" : "true", "componentId" : "kudos.widget.button", "context" : "", } { } "showCountOnly" : "false", { } ] "event" : "RevokeSolutionAction", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "quiltName" : "ForumMessage", "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { $('.lia-autocomplete-footer').append(ctaHTML); LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "event" : "markAsSpamWithoutRedirect", "context" : "", } }, } } else { }, count = 0; return; "action" : "rerender" "actions" : [ "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ ] } { { count = 0; "eventActions" : [ { "}); }, "event" : "AcceptSolutionAction", "event" : "approveMessage", "forceSearchRequestParameterForBlurbBuilder" : "false", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/0F94F452D57A978C27D2D3E5195EDB37/responsive_peak/images/button_dialog_close.svg", "revokeMode" : "true", "event" : "MessagesWidgetEditAction", }); LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "context" : "", "action" : "rerender" "initiatorBinding" : true, "entity" : "1671935", ] "message" : "1671935", "event" : "MessagesWidgetMessageEdit", "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", return false; } "action" : "rerender" "entity" : "1668309", LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); "actions" : [ "actions" : [ "event" : "unapproveMessage", $(this).removeClass('active'); "truncateBody" : "true", "parameters" : { { }, { } ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" ] { "kudosLinksDisabled" : "false", window.location = "https://forum.vodafone.de/t5/Archiv-CallYa/CallYa-Guthaben-wurde-nicht-gutgeschrieben-oder-doch/td-p/1667751" + "/page/" + val; return false; } }, } { }, "event" : "ProductAnswerComment", "initiatorBinding" : true, }, ] "truncateBody" : "true", { } { ] ], { "message" : "1668309", { ] ;(function($) { { ] ;(function($) { Bist du sicher, dass du fortfahren möchtest? } "disableLinks" : "false", ] "event" : "MessagesWidgetMessageEdit", "event" : "MessagesWidgetMessageEdit", { } ] "action" : "rerender" { "event" : "approveMessage", "actions" : [ return true; ] "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); ] "event" : "MessagesWidgetEditAction", LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "envParam:quiltName", "context" : "", ], }, ] ', 'ajax'); "event" : "kudoEntity", { "event" : "ProductAnswerComment", "truncateBody" : "true", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1668159,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "action" : "pulsate" "action" : "rerender" "actions" : [ }, ], lithadmin: [] "action" : "rerender" "context" : "", }, "parameters" : { }, Bist du sicher, dass du fortfahren möchtest? ] "useSimpleView" : "false", "event" : "ProductAnswerComment", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); "context" : "envParam:entity", "quiltName" : "ForumMessage", } } "context" : "", "action" : "pulsate" if ( neededkeys[count] == key ) { "event" : "removeMessageUserEmailSubscription", { { ] "event" : "markAsSpamWithoutRedirect", ] "actions" : [ }, "event" : "AcceptSolutionAction", "action" : "rerender" } LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ ] } ] "actions" : [ "displaySubject" : "true", "event" : "deleteMessage", "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ ] $('#vodafone-community-header .lia-search-input-wrapper').hide(); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ { LITHIUM.AjaxSupport.fromForm('#form_9', 'GiveRating', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } "actions" : [ "componentId" : "kudos.widget.button", "action" : "pulsate" "actions" : [ "linkDisabled" : "false" } "activecastFullscreen" : false, } "actions" : [ "message" : "1670200", }); "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1670043,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "", ] { ] ], "event" : "markAsSpamWithoutRedirect", Hatte auch die Bestätigung, dass mein Guthaben 32 € betrüge. "context" : "", }, }, "event" : "ProductAnswerComment", "context" : "", "actions" : [ "event" : "MessagesWidgetEditAnswerForm", }, }, "context" : "", } ] { "context" : "envParam:quiltName,product,contextId,contextUrl", { ] "event" : "QuickReply", LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); "forceSearchRequestParameterForBlurbBuilder" : "false", { "action" : "rerender" "actions" : [ "event" : "removeThreadUserEmailSubscription", "context" : "", { }, "context" : "envParam:quiltName", "dialogKey" : "dialogKey" "actions" : [ "action" : "rerender" "context" : "", "context" : "envParam:quiltName,message", LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_2db3b7ab02b0ad","tooltipContentSelector":"#link_2db3b7ab02b0ad_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_2db3b7ab02b0ad_0-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); { }, "}); "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1671935 .lia-rating-control-passive', '#form_8'); "context" : "", ] { ] }, "initiatorBinding" : true, { "kudosable" : "true", "event" : "editProductMessage", "selector" : "#messageview_3", }, }, { }, } "actions" : [ "actions" : [ { "actions" : [ ], "eventActions" : [ { } } "actions" : [ { }, $('#node-menu li.has-sub>a').on('click', function(){ "action" : "rerender" "context" : "envParam:quiltName,message", }, "selector" : "#kudosButtonV2_4", "actions" : [ "displayStyle" : "horizontal", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/61457","ajaxErrorEventName":"LITHIUM:ajaxError","token":"MK8zM2h2A4-xw9kk7_BiI3YQyL4bd6_9ZRU9PxyoUcE. ] "context" : "", } { } "disallowZeroCount" : "false", "message" : "1672428", "action" : "rerender" ] } "context" : "envParam:entity", ] "actions" : [ "actions" : [ { } } }, } LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'GrpQxdqQPL9l4CsvnQDTcq9uF6D1e_O4wo5gqutumxE. } "action" : "pulsate" "context" : "", "actions" : [ }, }, // --> return false; "actions" : [ } "action" : "rerender" "action" : "rerender" "event" : "expandMessage", "action" : "rerender" ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_8","menuItemsSelector":".lia-menu-dropdown-items"}}); }); "eventActions" : [ { "action" : "rerender" { "context" : "", { "event" : "QuickReply", LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1671935 .lia-rating-control-passive', '#form_8'); LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] "initiatorDataMatcher" : "data-lia-message-uid" }, { "event" : "kudoEntity", "action" : "rerender" { "context" : "envParam:entity", }, "action" : "pulsate" "actions" : [ "action" : "rerender" "linkDisabled" : "false" { } LITHIUM.AjaxSupport.ComponentEvents.set({ "initiatorBinding" : true, "actions" : [ } "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" "actions" : [ "event" : "RevokeSolutionAction", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_54","feedbackSelector":".InfoMessage"}); "actions" : [ "action" : "rerender" ] } "actions" : [ }, Bist du sicher, dass du fortfahren möchtest? "actions" : [ }, "context" : "", }); "linkDisabled" : "false" "context" : "", { "event" : "approveMessage", { ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ { "revokeMode" : "true", }, { { }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_35","feedbackSelector":".InfoMessage"}); .attr('aria-selected','true'); Ja, ich möchte zukünftig wöchentlich den Mobilfunk-Newsletter erhalten. { "initiatorDataMatcher" : "data-lia-message-uid" "linkDisabled" : "false" { "actions" : [ "}); // enable redirect to login page when "logmein" is typed into the void =) document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); }, LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); { } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"});

China Restaurant 1230 Wien, Kawasaki Vulcan S 650 Sportauspuff, Digital River Invoices, Mit Semmelbrösel überbacken, Just Eat Voucher, Spaghetti Bolognese Rezept Italienisch, Hotel Traumblick Cochem,